PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002055P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 153aa    MW: 16939.8 Da    PI: 9.0772
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002055P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.32.6e-361168562
          zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    + +cprC+s +tkfCyynny+ sqPr+fCk+CrryWt GG lrnvPvGgg+rk+kk+s
  MELO3C002055P1 11 KCRCPRCNSLHTKFCYYNNYNYSQPRHFCKTCRRYWTLGGLLRNVPVGGGSRKSKKNS 68
                    578***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.0E-311266IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.0061266IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-181357IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101450IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MDSQSKPDEL KCRCPRCNSL HTKFCYYNNY NYSQPRHFCK TCRRYWTLGG LLRNVPVGGG  60
SRKSKKNSKP KRATFTDSAC NSNSGVIGSD LDMRSSPLKL NQSGDSPWNG REFEAGDPAA  120
EEGFGLDHLA TSSGDSGSSW LKFYGLTHHF NN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445935.11e-111PREDICTED: dof zinc finger protein DOF3.4-like
SwissprotQ9FGD64e-30DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLA0A0A0LTJ92e-86A0A0A0LTJ9_CUCSA; Uncharacterized protein
STRINGBRADI1G07600.13e-29(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2136133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-25DOF zinc finger protein 1